DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and clic1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:213 Identity:45/213 - (21%)
Similarity:80/213 - (37%) Gaps:62/213 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GVDLNMKLLKVMDGEQLKPEFVK-LNPQHCIPTLVDDGFSIWESRAILIY---------LVEKYG 77
            ||..|:..:.:    :.|||.:| |.|....|              .|:|         .:|:: 
Zfish    38 GVTFNVTTVDM----KRKPEILKDLAPGAQPP--------------FLLYGTEVKTDTNKIEEF- 83

  Fly    78 ADDSLYPSDPQKKAVVN---QRLYFDMGTLFQSFVEAIYPQIRNN-HPADPEAMQKVDSAFGHLD 138
            .:::|.|....:.|..|   .....|:.:.|.::::...||:.:| .....:|::|:|.   :|.
Zfish    84 LEETLCPPKYPRLAACNPESNTAGLDVFSKFSAYIKNSNPQMNDNLEKGLLKALKKLDD---YLS 145

  Fly   139 TFLEDQ--------------EYVAGDCLTIADIALLASVSTFEVV-----DFDIA-------QYP 177
            :.|.|:              .::.|..||:||..||..:...:||     .|.|.       :|.
Zfish   146 SPLPDEIDENSADDVISSTRSFLDGQELTLADCNLLPKLHIVKVVCLKFRGFSIPRSLTSLWRYL 210

  Fly   178 NVARWYENAKEVTPGWEE 195
            :.|...|......|..||
Zfish   211 DAAYAREEFSSTCPSDEE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 42/204 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 12/60 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/138 (22%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 15/73 (21%)
O-ClC 6..241 CDD:129941 45/213 (21%)
GST_C_CLIC1 100..238 CDD:198333 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.