DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:82 Identity:17/82 - (20%)
Similarity:34/82 - (41%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADD--SLYP- 84
            |:....:.:.:...|..:|.|::||....:|.::.....|.:...|:.|:...:..:.  :|.| 
  Rat    72 GLSCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPE 136

  Fly    85 -SDPQKKAVVNQRLYFD 100
             ..||...|:..|...|
  Rat   137 AGSPQHARVLQYRELLD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 17/82 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 10/50 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 4/13 (31%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 10/49 (20%)
GST_C_family 203..313 CDD:413470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.