Sequence 1: | NP_524916.1 | Gene: | GstD8 / 48341 | FlyBaseID: | FBgn0010044 | Length: | 212 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038913.1 | Gene: | Clic4 / 29876 | MGIID: | 1352754 | Length: | 253 | Species: | Mus musculus |
Alignment Length: | 209 | Identity: | 43/209 - (20%) |
---|---|---|---|
Similarity: | 75/209 - (35%) | Gaps: | 86/209 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 HPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILI 70
Fly 71 YLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEA--------M 127
Fly 128 QKVDSAFGHLDTFLEDQ--------------EYVAGDCLTIADIALLASVSTFEVV-----DFDI 173
Fly 174 AQ-YPNVARWYENA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD8 | NP_524916.1 | GstA | 1..188 | CDD:223698 | 43/209 (21%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 15/67 (22%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 26/127 (20%) | ||
Clic4 | NP_038913.1 | Required for insertion into the membrane. /evidence=ECO:0000250 | 2..101 | 7/33 (21%) | |
O-ClC | 17..252 | CDD:129941 | 43/209 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844467 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |