DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and Clic3

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:200 Identity:46/200 - (23%)
Similarity:75/200 - (37%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKY 76
            |:.:.|.....||...:..:.......:..:|.   |...:|.|:.||....::..|..:|.|..
  Rat    26 CQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFA---PGSQLPILLYDGDVKTDTLQIEEFLEETL 87

  Fly    77 GADD--SLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAM-QKVDSAFGHLD 138
            |..|  .|.|...:.....|     |:...|.:|       |:|..|...:|: |::..|...||
  Rat    88 GPPDFPGLAPRYRESNTAGN-----DIFHKFSAF-------IKNPVPTQDDALYQQLLRALTRLD 140

  Fly   139 TFLE---DQE-------------YVAGDCLTIADIALLASVSTFEVVDFDIAQYP------NVAR 181
            .:|.   |.|             ::.||.||:||.:||..:...:.|.....|.|      .|.|
  Rat   141 RYLGTPLDHELAQEPHLSESRRRFLDGDQLTLADCSLLPKLHIVDTVCAHFRQRPIPAELSCVRR 205

  Fly   182 WYENA 186
            :.::|
  Rat   206 YLDSA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 45/199 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 12/61 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/121 (23%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 45/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.