DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and Clic2

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:212 Identity:57/212 - (26%)
Similarity:83/212 - (39%) Gaps:62/212 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVK-----LNPQHCI--PTLVDDGFSIWESRAIL 69
            |:.:.|.....||..|:..:..    ..|||.:|     .||...|  ..|..|...|.|     
  Rat    33 CQRLFMILWLKGVKFNVTTIDT----ARKPEELKDLAPGTNPPFLIYNKELKTDFIKIEE----- 88

  Fly    70 IYLVEKYGADDSLYPS-DPQKKAVVNQRLYFDMG-TLFQSFVEAIYPQIRNNHPADPEAMQKVDS 132
              .:||..|... ||. .|:.|.      .||:| .||..|  :.|  |:|   ...||.:..:.
  Rat    89 --FLEKTLAPPR-YPHLSPKYKE------SFDVGCNLFAKF--SAY--IKN---TQKEANKNFEK 137

  Fly   133 A----FGHLDTFL-------------EDQE-----YVAGDCLTIADIALLASVSTFEVV-----D 170
            :    |..||.:|             |::.     ::.||.||:||.:||..::..:|.     |
  Rat   138 SLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRD 202

  Fly   171 FDI-AQYPNVARWYENA 186
            ||| |::..|.|:..||
  Rat   203 FDIPAEFSGVWRYLHNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 57/212 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/68 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 35/128 (27%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 18/73 (25%)
GST_N_CLIC 9..99 CDD:239359 19/77 (25%)
O-ClC 12..245 CDD:129941 57/212 (27%)
GST_C_CLIC2 106..244 CDD:198331 35/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.