DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTA3

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_000838.3 Gene:GSTA3 / 2940 HGNCID:4628 Length:222 Species:Homo sapiens


Alignment Length:168 Identity:44/168 - (26%)
Similarity:83/168 - (49%) Gaps:24/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ALGVDLNMKLL-KVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADDSLYP 84
            |.||:...|.: ...|..:|:.:...:..|  :|.:..||..:.::||||.|:..||    :||.
Human    25 AAGVEFEEKFIGSAEDLGKLRNDGSLMFQQ--VPMVEIDGMKLVQTRAILNYIASKY----NLYG 83

  Fly    85 SDPQKKAVVNQRLYFD-MGTLFQSFVEAIYPQIRNNHPADPEA-----MQKVDSA-FGHLDTFLE 142
            .|.:::|:::  :|.: |..|.:..:  :.|..|   |.:.:|     .:|..|. |...:..|:
Human    84 KDIKERALID--MYTEGMADLNEMIL--LLPLCR---PEEKDAKIALIKEKTKSRYFPAFEKVLQ 141

  Fly   143 D--QEYVAGDCLTIADIALLASVSTFEVVDFD-IAQYP 177
            .  |:|:.|:.|:.|||:|:..:...|.:|.. |:.:|
Human   142 SHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFP 179

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 44/168 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/53 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/100 (24%)
GSTA3NP_000838.3 GST_N_Alpha 4..82 CDD:239375 17/62 (27%)
Glutathione binding. /evidence=ECO:0000269|PubMed:15595823, ECO:0000269|PubMed:20083122 54..55 1/2 (50%)