DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GSTT4

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:198 Identity:50/198 - (25%)
Similarity:93/198 - (46%) Gaps:22/198 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWES 65
            ::.|....|||||:|.:.:|...:..|.:.:.::.|......::.:||...:|:|.|..|.:.||
Human     3 LELYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSES 67

  Fly    66 RAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQ------SFVEAIYPQIRNNHPADP 124
            .|||.||..||.|.....|.||..:|.|::.:.: ..|.||      .:::.:.|:|.....:..
Human    68 AAILYYLCRKYSAPSHWCPPDPHARARVDEFVAW-QHTAFQLPMKKIVWLKLLIPKITGEEVSAE 131

  Fly   125 EAMQKVDSAFGHL----DTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQY------PNV 179
            :....|:.....|    :.||:|:.::.|:.:::||:     |:..|::....|.|      ..:
Human   132 KMEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLADL-----VAVVEMMQPMAANYNVFLNSSKL 191

  Fly   180 ARW 182
            |.|
Human   192 AEW 194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 50/198 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/111 (19%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 23/74 (31%)