DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and gst2

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:57/201 - (28%)
Similarity:87/201 - (43%) Gaps:45/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVD---DGFSIWESRAILIYLVEKY 76
            |::..|.|.:...........|||...|.:.|||...:|||||   :.::||||.||||||.:||
pombe    18 VVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNNDYTIWESDAILIYLADKY 82

  Fly    77 GADD--SLYPSDPQKKAVVNQRLYFD---MGTL------FQSF----VEAIYPQIRNNHPADPEA 126
            ..|.  ||...||:...:: |.|:|.   .|.:      |..|    |.:...:.||        
pombe    83 DTDRKISLSFDDPEYYKLI-QYLFFQASGQGVIWGQAGWFNFFHHEPVVSAVTRYRN-------- 138

  Fly   127 MQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALL------------ASVSTFEVV---DFDIAQY 176
              ::....|.|:..|:|::|:..:..||||::.:            ...|..|.|   ||: .::
pombe   139 --EIKRVLGVLEDILKDRDYLVANKYTIADLSFIPWNYNLGGLFGEGKFSFKEEVPQLDFE-KEF 200

  Fly   177 PNVARW 182
            |....|
pombe   201 PKAYAW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 57/201 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/61 (41%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/123 (20%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 27/65 (42%)
GstA 5..226 CDD:223698 57/201 (28%)
GST_C_Ure2p 96..219 CDD:198326 25/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.