DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and gst1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:202 Identity:51/202 - (25%)
Similarity:90/202 - (44%) Gaps:43/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVD---DGFSIWESRAILIYLVEKY 76
            |:...|.|.:....:.:.....||..||.:.|||...:|||:|   :.::||||.||||||.:||
pombe    18 VVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNNDYTIWESDAILIYLADKY 82

  Fly    77 GADDSL-YPSDPQKKAVVNQRLYFD---MGTLF----------QSFVEAIYPQIRNNHPADPEAM 127
            ..:..: .|.|..:...|.|.|:|.   .|.::          |..|.:...:.||         
pombe    83 DTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYHQELVISAITRYRN--------- 138

  Fly   128 QKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVV---------------DFDIAQYP 177
             ::....|.|:..|:|::|:..:..||||::.::..:..|::               ||: .::|
pombe   139 -EIKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIFAEGKFSIEEEVPQLDFE-KEFP 201

  Fly   178 NVARWYE 184
            ....|::
pombe   202 RTYSWHQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 51/202 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 24/61 (39%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/125 (18%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 26/65 (40%)
GstA 5..218 CDD:223698 51/202 (25%)
GST_C_Ure2p 96..219 CDD:198326 23/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.