DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and GstT2

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:204 Identity:50/204 - (24%)
Similarity:90/204 - (44%) Gaps:27/204 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRA 67
            |||...|...|.:.:..|.....:....:.:...|||..|:.|:|....:|.:|...|.:.|:.|
  Fly     7 FYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIA 71

  Fly    68 ILIYLVEKYGADDSLYPSDPQKKAVVNQ-------------RLYFDMGTLFQSFVEAIYPQIRNN 119
            |:.||.:|...|:.|||...:.:|.|::             .:||....||.  :..|.|:.:  
  Fly    72 IIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFP--MNGIAPKPK-- 132

  Fly   120 HPADPEAMQK----VDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDF--DIAQYPN 178
                ||.:|.    |::..|.|:....:.:::.|..||:|||...:.::...:..:  |..::|.
  Fly   133 ----PEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPK 193

  Fly   179 VARWYENAK 187
            |.:|.|..:
  Fly   194 VVKWLERVR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 50/204 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/70 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/119 (21%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 20/72 (28%)
GstA 7..202 CDD:223698 50/202 (25%)
GST_C_family 93..218 CDD:295467 25/118 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.