DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and Gstp3

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_030106733.1 Gene:Gstp3 / 225884 MGIID:2385078 Length:260 Species:Mus musculus


Alignment Length:182 Identity:45/182 - (24%)
Similarity:72/182 - (39%) Gaps:41/182 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LGVDLN------MKLLKVMDGEQLKPEFVKLN-------PQHC----IPTLVDDGFSIWESRAIL 69
            ||.|.:      |::|....|:..|.|.|.|:       ...|    ||...|...::::|..||
Mouse    56 LGQDYSCGRCEVMRMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQDGELTLYQSNTIL 120

  Fly    70 IYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAF 134
            .:|...:|    ||..|.|:.|:|:.     :....:.....|..|.|:......:..||  ...
Mouse   121 RHLGRSFG----LYGKDQQEAALVDM-----VNDGLEDLFRRIARQYRHILKEGKDQYQK--ELP 174

  Fly   135 GHL---DTFLED----QEYVAGDCLTIADIALLASVSTFEVV------DFDI 173
            |||   :|.|..    |.::.||.::.||..||..:...|::      ||.:
Mouse   175 GHLKPFETLLAQNRGGQSFIVGDQISFADYRLLDVLLNLELLFPGYLNDFPL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 45/182 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/68 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/99 (23%)
Gstp3XP_030106733.1 Thioredoxin_like 63..126 CDD:381987 15/62 (24%)
GST_C_family 134..253 CDD:383119 23/100 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.