DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and EEF1G

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens


Alignment Length:175 Identity:46/175 - (26%)
Similarity:85/175 - (48%) Gaps:13/175 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PEFVKLNPQHCIPTLV-DDGFSIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTL 104
            |||::..|...:|... ||||.::||.||..|:     :::.|..|.|:..|.|.|.:.|....:
Human    47 PEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV-----SNEELRGSTPEAAAQVVQWVSFADSDI 106

  Fly   105 FQSFVEAIYPQI---RNNHPADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTF 166
            .......::|.:   .:|..|...|.::|....|.||.:|:.:.::.|:.:|:|||.::.::...
Human   107 VPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWL 171

  Fly   167 --EVVDFDIAQ-YPNVARWYENAKEVTPGWEENWDGVQLIKKLVQ 208
              :|::....| :||..||:..... .|.:......|:|.:|:.|
Human   172 YKQVLEPSFRQAFPNTNRWFLTCIN-QPQFRAVLGEVKLCEKMAQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 41/153 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 14/33 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/121 (22%)
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 14/39 (36%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 27/122 (22%)
tolA <212..>278 CDD:236545 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 277..381 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.