DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and gst-15

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_496860.1 Gene:gst-15 / 185410 WormBaseID:WBGene00001763 Length:213 Species:Caenorhabditis elegans


Alignment Length:159 Identity:44/159 - (27%)
Similarity:70/159 - (44%) Gaps:23/159 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IPTLVDDGFSIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQI 116
            :|.|..|||.|.:|.||..||.:|:|........:....|||:|  :.|....|::.:.|    .
 Worm    55 LPVLNVDGFDIPQSAAICRYLAKKFGYAGKTPEEEAWADAVVDQ--FKDFSVAFKTLLFA----T 113

  Fly   117 RNNHPADPEAMQKV---------DSAFGHLDTFLEDQE--YVAGDCLTIADIAL---LASVSTFE 167
            |...|  .|.:.|:         |..|..|:..|:..:  |:.||.||.||:.:   |.|:....
 Worm   114 RAGKP--EEEILKIRYEIFNPARDVYFILLNRILKKSKSGYLVGDGLTWADLVIADNLHSLEKLR 176

  Fly   168 VVDFDIAQYPNVARWYENAKEVTPGWEEN 196
            .:|.|...:.|:.::.|.... ||..|::
 Worm   177 AIDDDDEGHQNLKKYKEKIYG-TPDLEDH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 41/149 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 11/21 (52%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/123 (25%)
gst-15NP_496860.1 GST_N_Sigma_like 4..77 CDD:239337 11/21 (52%)
PTZ00057 6..211 CDD:173353 44/159 (28%)
GST_C_Sigma_like 87..195 CDD:198301 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.