DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and gst-14

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_496861.1 Gene:gst-14 / 185409 WormBaseID:WBGene00001762 Length:210 Species:Caenorhabditis elegans


Alignment Length:174 Identity:44/174 - (25%)
Similarity:72/174 - (41%) Gaps:29/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PCRSVIMTAKAL----GVDLNMKLLKVMDG--EQLKPEFVKLNPQHCIPTLVDDGFSIWESRAIL 69
            |.|.:..:|:.|    ||....:.:..:|.  |::|.:    .|...:|.|..|.|.|.:|.||.
 Worm    10 PVRGLAESARLLFHLAGVPFEDERVNFLDDTWEKMKGK----TPMGQLPVLTVDDFEIPQSAAIN 70

  Fly    70 IYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQK----- 129
            .||..|:|........:....|||:|  :.|....|:..|      |........|.::|     
 Worm    71 RYLARKFGFAGKTPEEEAWVDAVVDQ--FKDFFAEFRKLV------IAKRVGKSAEELEKLTAEV 127

  Fly   130 ----VDSAFGHLDTFLEDQE--YVAGDCLTIADIALLASVSTFE 167
                :|..|..|:..||..:  |:.||.:|.||:.:..::.|.:
 Worm   128 IKPAMDVYFKVLNGLLEKSKSGYLIGDSITFADLYIADNIQTLK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 44/174 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/68 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/91 (24%)
gst-14NP_496861.1 GST_N_Sigma_like 4..75 CDD:239337 20/68 (29%)
PTZ00057 6..205 CDD:173353 44/174 (25%)
GST_C_Sigma_like 85..192 CDD:198301 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.