DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and gst-42

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:188 Identity:54/188 - (28%)
Similarity:86/188 - (45%) Gaps:17/188 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRSVIMTAKAL-GVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEK 75
            |...:..|.|| .||...|.:.:: .|:.|.:..::||...:||.|.||..|.||.||:.||.|.
 Worm    16 CSWRVRIALALKNVDYEYKTVDLL-SEEAKSKLKEINPAAKVPTFVVDGQVITESLAIIEYLEET 79

  Fly    76 YGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYP----QIRNNHPA---DPEAMQKVDSA 133
            : .|..|.|.||.|:|....     :..|..|.::.::.    |:.|...|   ...|.|.|...
 Worm    80 H-PDVPLLPKDPIKRAHARA-----ISLLVASGIQPLHNLKVLQLLNKKEAGFGGQFAKQFVVEG 138

  Fly   134 FGHLDTFLEDQ--EYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKEV 189
            ...|:..|:..  :|..||.:||||:::...:.:....:.|::.||.|.|..|...::
 Worm   139 LTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSANRFNLDLSPYPTVNRINETLADI 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 54/185 (29%)
GST_N_Delta_Epsilon 1..74 CDD:239343 23/62 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/111 (23%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 22/61 (36%)
maiA 7..211 CDD:273527 54/188 (29%)
GST_C_Zeta 90..207 CDD:198300 26/112 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.