Sequence 1: | NP_524916.1 | Gene: | GstD8 / 48341 | FlyBaseID: | FBgn0010044 | Length: | 212 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011241675.1 | Gene: | Gstt2 / 14872 | MGIID: | 106188 | Length: | 251 | Species: | Mus musculus |
Alignment Length: | 209 | Identity: | 49/209 - (23%) |
---|---|---|---|
Similarity: | 94/209 - (44%) | Gaps: | 28/209 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWE- 64
Fly 65 ------SRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSF--------------V 109
Fly 110 EAIYPQIRNNHPADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIA 174
Fly 175 Q-YPNVARWYENAK 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD8 | NP_524916.1 | GstA | 1..188 | CDD:223698 | 49/209 (23%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 23/79 (29%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 20/115 (17%) | ||
Gstt2 | XP_011241675.1 | GST_N_Theta | 3..85 | CDD:239348 | 23/81 (28%) |
GST_C_Theta | 98..223 | CDD:198292 | 19/114 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844526 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100130 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.650 |