DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and Gsta2

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_032208.2 Gene:Gsta2 / 14858 MGIID:95863 Length:222 Species:Mus musculus


Alignment Length:199 Identity:48/199 - (24%)
Similarity:84/199 - (42%) Gaps:45/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ALGVDLNMKLLK-VMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADDSLYP 84
            |.||:...|.:: ..|.|:||.:...:..|  :|.:..||..:.::||||.|:..||    .||.
Mouse    25 AAGVEFEEKFIQSPEDLEKLKKDGNLMFDQ--VPMVEIDGMKLVQTRAILNYIATKY----DLYG 83

  Fly    85 SDPQKKAVVNQRLYFD--------MGTLF-----QSFVEAIYPQIRNNHPADPEAMQKVDSAFGH 136
            .|.:::|:::  :|.:        :|.|.     |...:....:.|..:...| |.:||..:.| 
Mouse    84 KDMKERALID--MYTEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLP-AFEKVLKSHG- 144

  Fly   137 LDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFD--------------IAQYPNVARWYENAK 187
                   |:|:.|:.||..|:.||..:...|.:|..              |:..|||.::.....
Mouse   145 -------QDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPLLKAFKSRISSLPNVKKFLHPGS 202

  Fly   188 EVTP 191
            :..|
Mouse   203 QRKP 206

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 47/194 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 17/53 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/131 (20%)
Gsta2NP_032208.2 GST_N_Alpha 4..82 CDD:239375 19/62 (31%)
Glutathione binding. /evidence=ECO:0000305|PubMed:12549910 54..55 1/2 (50%)