DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and CLIC2

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:213 Identity:55/213 - (25%)
Similarity:84/213 - (39%) Gaps:64/213 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRSVIMTAKALGVDLNMKLLKV-MDGEQLK-------PEFVKLNPQHCIPTLVDDGFSIWESRAI 68
            |:.:.|.....||..|:..:.: ...|:||       |.|:..|.:     |..|...|.|    
Human    33 CQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKE-----LKTDFIKIEE---- 88

  Fly    69 LIYLVEKYGADDSLYPS-DPQKKAVVNQRLYFDMG-TLFQSFVEAIYPQIRNNHPADPEAMQKVD 131
               .:|:..|... ||. .|:.|.      .||:| .||..|  :.|  |:|   ...||.:..:
Human    89 ---FLEQTLAPPR-YPHLSPKYKE------SFDVGCNLFAKF--SAY--IKN---TQKEANKNFE 136

  Fly   132 SA----FGHLDTFLE-------DQE-----------YVAGDCLTIADIALLASVSTFEVV----- 169
            .:    |..||.:|.       |.:           ::.||.||:||.:||..::..:|.     
Human   137 KSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYR 201

  Fly   170 DFDI-AQYPNVARWYENA 186
            |||| |::..|.|:..||
Human   202 DFDIPAEFSGVWRYLHNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 55/213 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/69 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 35/128 (27%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 16/74 (22%)
N-terminal 1..94 16/72 (22%)
O-ClC 12..245 CDD:129941 55/213 (26%)
Joint loop 95..106 4/11 (36%)
C-terminal 107..247 35/126 (28%)
Foot loop 151..171 1/19 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.