powered by:
Protein Alignment GstD8 and CLIC1
DIOPT Version :9
Sequence 1: | NP_524916.1 |
Gene: | GstD8 / 48341 |
FlyBaseID: | FBgn0010044 |
Length: | 212 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001274522.1 |
Gene: | CLIC1 / 1192 |
HGNCID: | 2062 |
Length: | 241 |
Species: | Homo sapiens |
Alignment Length: | 133 |
Identity: | 31/133 - (23%) |
Similarity: | 54/133 - (40%) |
Gaps: | 52/133 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 QSFVEAI-----YPQ----------------------IRNNHPADPEAMQK-VDSAFGHLDTFL- 141
:.|:||: ||: |:|::||..:.::| :..|...||.:|
Human 81 EEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLT 145
Fly 142 ------------EDQ-----EYVAGDCLTIADIALLASVSTFEVV-----DFDIAQ-YPNVARWY 183
||: :::.|:.||:||..||..:...:|| .|.|.: :..|.|:.
Human 146 SPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL 210
Fly 184 ENA 186
.||
Human 211 SNA 213
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165154484 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.