DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstD8 and Clic1

DIOPT Version :9

Sequence 1:	NP_524916.1	Gene:	GstD8 / 48341	FlyBaseID:	FBgn0010044	Length:	212	Species:	Drosophila melanogaster
Sequence 2:	NP_254279.1	Gene:	Clic1 / 114584	MGIID:	2148924	Length:	241	Species:	Mus musculus

Alignment Length:	133	Identity:	31/133 - (23%)
Similarity:	54/133 - (40%)	Gaps:	52/133 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly   106 QSFVEAI-----YPQ----------------------IRNNHPADPEAMQK-VDSAFGHLDTFL- 141
            :.|:||:     ||:                      |:|::||..:.::| :..|...||.:|
Mouse    81 EEFLEAMLCPPRYPKLAALNPESNTSGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLT 145

  Fly   142 ------------EDQ-----EYVAGDCLTIADIALLASVSTFEVV-----DFDIAQ-YPNVARWY 183
                        ||:     :::.|:.||:||..||..:...:||     .|.|.: :..|.|:.
Mouse   146 SPLPEEVDETSAEDEGISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL 210

  Fly   184 ENA 186
            .||
Mouse   211 SNA 213

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstD8	NP_524916.1	GstA	1..188	CDD:223698	31/133 (23%)
		GST_N_Delta_Epsilon	1..74	CDD:239343
		GST_C_Delta_Epsilon	88..204	CDD:198287	31/133 (23%)
Clic1	NP_254279.1	Required for insertion into the membrane. /evidence=ECO:0000250	2..90		3/8 (38%)
Clic1	NP_254279.1	O-ClC	6..241	CDD:129941	31/133 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167844762
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930