DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and gstz1

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:193 Identity:51/193 - (26%)
Similarity:88/193 - (45%) Gaps:34/193 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FYYHPCSAPCRSVIMTAKALGVDLNMKLLKVM--DGEQLKPEFVKLNPQHCIPTLVDDGFSIWES 65
            ::...||...| :.:..|  |::.:.:::.::  .|.||..|:.::||...:|.|..||.::.:|
 Frog    12 YFRSSCSWRVR-IALAFK--GIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGVTLSQS 73

  Fly    66 RAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKV 130
            .||:.|| |:...:..|.|.||:|:|.|  |:..|      .....|.| ::|..     .:||:
 Frog    74 LAIIEYL-EETRPNPPLLPRDPKKRAQV--RMISD------QIASGIQP-LQNLC-----VLQKI 123

  Fly   131 DS------------AFGHLDTFLEDQ--EYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNV 179
            ..            .|..|:..|:..  .|..||.:||||:.|:..|:.......|:|.||.:
 Frog   124 GETKLEWAKHFITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVANAVRFKVDLAPYPTI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 51/193 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/106 (25%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 51/193 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.