DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD8 and Gsta5

DIOPT Version :9

Sequence 1:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001116132.1 Gene:Gsta5 / 100042314 MGIID:3704339 Length:222 Species:Mus musculus


Alignment Length:201 Identity:49/201 - (24%)
Similarity:84/201 - (41%) Gaps:49/201 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ALGVDLNMKLLK-VMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADDSLYP 84
            |.||:...|.:: ..|.|:||.:...:..|  :|.:..||..:.::||||.|:..||    .||.
Mouse    25 AAGVEFEEKFIQSPEDLEKLKKDGNLMFDQ--VPMVEIDGMKLVQTRAILNYIATKY----DLYG 83

  Fly    85 SDPQKKAVVNQRLYFD--------MGTLF-----QSFVEAIYPQIRNNHPADPEAMQKVDSAFGH 136
            .|.:::|:::  :|.:        :|.|.     |...:....:.|..:...| |.:||....| 
Mouse    84 KDMKERALID--MYSEGILDLTEMIGQLLICPPDQKEAKTALAKDRTKNRYLP-AFEKVLKGHG- 144

  Fly   137 LDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFD----------------IAQYPNVARWYEN 185
                   |:|:.|:.||..|:.||..:  ..|.:||                |:..|||.::...
Mouse   145 -------QDYLVGNRLTRVDVHLLELL--LYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLHP 200

  Fly   186 AKEVTP 191
            ..:..|
Mouse   201 GSQRKP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD8NP_524916.1 GstA 1..188 CDD:223698 48/196 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 17/53 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/133 (20%)
Gsta5NP_001116132.1 PTZ00057 1..198 CDD:173353 48/191 (25%)
GST_N_Alpha 4..82 CDD:239375 19/62 (31%)
GST_C_family 86..220 CDD:295467 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D485985at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.