Sequence 1: | NP_524916.1 | Gene: | GstD8 / 48341 | FlyBaseID: | FBgn0010044 | Length: | 212 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001116132.1 | Gene: | Gsta5 / 100042314 | MGIID: | 3704339 | Length: | 222 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 49/201 - (24%) |
---|---|---|---|
Similarity: | 84/201 - (41%) | Gaps: | 49/201 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 ALGVDLNMKLLK-VMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLVEKYGADDSLYP 84
Fly 85 SDPQKKAVVNQRLYFD--------MGTLF-----QSFVEAIYPQIRNNHPADPEAMQKVDSAFGH 136
Fly 137 LDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFD----------------IAQYPNVARWYEN 185
Fly 186 AKEVTP 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD8 | NP_524916.1 | GstA | 1..188 | CDD:223698 | 48/196 (24%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 17/53 (32%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 27/133 (20%) | ||
Gsta5 | NP_001116132.1 | PTZ00057 | 1..198 | CDD:173353 | 48/191 (25%) |
GST_N_Alpha | 4..82 | CDD:239375 | 19/62 (31%) | ||
GST_C_family | 86..220 | CDD:295467 | 27/134 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D485985at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |