Sequence 1: | NP_525114.1 | Gene: | GstD7 / 48340 | FlyBaseID: | FBgn0010043 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004271.1 | Gene: | EEF1E1 / 9521 | HGNCID: | 3212 | Length: | 174 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 44/197 - (22%) |
---|---|---|---|
Similarity: | 87/197 - (44%) | Gaps: | 43/197 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 ASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTL-VDNGFVIWESRAIAVYLVE 77
Fly 78 KYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLN 142
Fly 143 TFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLS-----KFPNVERWLKNAPKVTPGWEQNLE 202
Fly 203 SL 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD7 | NP_525114.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 15/63 (24%) |
GstA | 6..188 | CDD:223698 | 39/179 (22%) | ||
GST_C_Delta_Epsilon | 92..206 | CDD:198287 | 26/118 (22%) | ||
EEF1E1 | NP_004271.1 | N-terminal | 2..56 | 16/66 (24%) | |
Linker | 57..63 | 2/7 (29%) | |||
C-terminal | 64..152 | 21/107 (20%) | |||
GST_C_AIMP3 | 65..165 | CDD:198338 | 26/119 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |