DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTO1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens


Alignment Length:219 Identity:53/219 - (24%)
Similarity:94/219 - (42%) Gaps:33/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLDLYNFPMAPASRAIQMVAKALGLE---LNSKLINTMEGDQLKPE-FVRINPQHTIPTLVDN-G 62
            ::.:|:....|.:...::|.||.|:.   :|..|.|       ||| |.:.||...:|.|.:: |
Human    23 SIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKN-------KPEWFFKKNPFGLVPVLENSQG 80

  Fly    63 FVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGD 127
            .:|:||.....||.|.|  |...|.|:||.::|.  |::..::.:...:|...|   .|:....|
Human    81 QLIYESAITCEYLDEAY--PGKKLLPDDPYEKAC--QKMILELFSKVPSLVGSF---IRSQNKED 138

  Fly   128 QEAL-DKVNSAFGFLNTFLEGQ--DFVAGSQLTVADIVILATVSTVEWFSFD--LSKFPNVERW- 186
            ...| ::....|..|...|..:  .|..|:.:::.|.:|......:|....:  :...|.::.| 
Human   139 YAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWM 203

  Fly   187 --LKNAPKVT------PGWEQNLE 202
              :|..|.|:      ..|:..||
Human   204 AAMKEDPTVSALLTSEKDWQGFLE 227

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 23/77 (30%)
GstA 6..188 CDD:223698 47/194 (24%)
GST_C_Delta_Epsilon 92..206 CDD:198287 23/125 (18%)
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 22/77 (29%)