DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and Clic5

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:224 Identity:47/224 - (20%)
Similarity:87/224 - (38%) Gaps:51/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PNLDLY--------NFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTL 58
            |.::|:        :....|.|:.:.|:....|:..|   :.|::..:...:...:.|....|.|
  Rat    14 PEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFN---VTTVDLKRKPADLHNLAPGTHPPFL 75

  Fly    59 VDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTG 123
            ..||.|..:...|..:|.|..          .|:|...:..|.........|..:|:...|..|.
  Rat    76 TFNGDVKTDVNKIEEFLEETL----------TPEKYPKLAARHRESNTAGIDIFSKFSAYIKNTK 130

  Fly   124 -------KFGDQEALDKVNSAFGFLNTFL--------EGQD------FVAGSQLTVADIVILATV 167
                   :.|..:||.|::.   :|||.|        .|.:      |:.|.:||:||..:|..:
  Rat   131 QQNNAALERGLTKALRKLDD---YLNTPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKL 192

  Fly   168 STV-----EWFSFDL-SKFPNVERWLKNA 190
            ..|     ::.::|: ::...:.|:||||
  Rat   193 HVVKIVAKKYRNYDIPAEMTGLWRYLKNA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/80 (19%)
GstA 6..188 CDD:223698 42/216 (19%)
GST_C_Delta_Epsilon 92..206 CDD:198287 29/126 (23%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 17/96 (18%)
O-ClC 14..249 CDD:129941 47/224 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.