DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and CLIC3

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:215 Identity:42/215 - (19%)
Similarity:75/215 - (34%) Gaps:39/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRAIAVYLVE 77
            |:.:.:.||....|:......::|.....:..:|.   |...:|.|:.:.....::..|..:|.|
Human    23 PSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFA---PGSQLPILLYDSDAKTDTLQIEDFLEE 84

  Fly    78 KYGKPDSP-LYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFL 141
            ..|.||.| |.|...:.....|           |...|:...|.......|:....::..|...|
Human    85 TLGPPDFPSLAPRYRESNTAGN-----------DVFHKFSAFIKNPVPAQDEALYQQLLRALARL 138

  Fly   142 NTFLEG----------------QDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNA 190
            :::|..                :.|:.|.:||:||..:|..:..|:.......:.|        .
Human   139 DSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAP--------I 195

  Fly   191 PKVTPGWEQNLESLQQGKKF 210
            |....|..:.|:|..|.|:|
Human   196 PAELRGVRRYLDSAMQEKEF 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 11/63 (17%)
GstA 6..188 CDD:223698 35/191 (18%)
GST_C_Delta_Epsilon 92..206 CDD:198287 21/129 (16%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 12/67 (18%)
PLN02817 5..229 CDD:330276 42/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.