DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and URE2

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:56/230 - (24%)
Similarity:96/230 - (41%) Gaps:51/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNG---FVIWE 67
            |::...||....:.:|...||...|:..::...|:...||||.:||...:|.|:|:|   ..|||
Yeast   116 LFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWE 180

  Fly    68 SRAIAVYLVEKY----GKPDSPLYPNDPQKRALINQRLYFDMG----TLYDALTKYFFLIFRTGK 124
            |.||.::||.||    |.|  .|:.:|...::.||..|:|...    .:..||   .|..|.:.|
Yeast   181 SGAILLHLVNKYYKETGNP--LLWSDDLADQSQINAWLFFQTSGHAPMIGQAL---HFRYFHSQK 240

  Fly   125 FGD--QEALDKVNSAFGFL--------------------------------NTFLEGQDFVAGSQ 155
            ...  :...|:|...:|.:                                :.|.:...::.|.:
Yeast   241 IASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDK 305

  Fly   156 LTVADIVILATVSTVEWFSFDLS-KFPNVERWLKN 189
            ||:||:..:...:.|:....::. :||.|.:|.|:
Yeast   306 LTIADLAFVPWNNVVDRIGINIKIEFPEVYKWTKH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/73 (34%)
GstA 6..188 CDD:223698 55/227 (24%)
GST_C_Delta_Epsilon 92..206 CDD:198287 24/137 (18%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 28/77 (36%)
GST_C_Ure2p 208..350 CDD:198326 24/136 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2827
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.