DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GTT1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:45/214 - (21%)
Similarity:80/214 - (37%) Gaps:55/214 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SRAIQMVAKALGLELNSKLINTMEGDQLK--PEFVRINPQHTIPTL------VDNGFVIWESRAI 71
            |||.:::.....|.|..:::........:  ||..:|:|....|.|      .....::.||..|
Yeast    14 SRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDRETGKKKILAESGFI 78

  Fly    72 AVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGD--------- 127
            ..|:::.:.. ...|...|......||..|::..|:|...|...|.|    .|..|         
Yeast    79 FQYVLQHFDH-SHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFIL----SKVKDSGMPFPISY 138

  Fly   128 --QEALDKVNSAF--GFLNT---FLEGQ-----DFVAGSQLTVADIVILATVSTVEWFSFDL--- 177
              ::..||::.|:  |.:..   |:||:     .::...:|:.|||::          ||.|   
Yeast   139 LARKVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILM----------SFPLQMA 193

  Fly   178 --------SKFPNVERWLK 188
                    ..:|.:.:|||
Yeast   194 FERKFAAPEDYPAISKWLK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/69 (22%)
GstA 6..188 CDD:223698 43/212 (20%)
GST_C_Delta_Epsilon 92..206 CDD:198287 28/129 (22%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 15/72 (21%)
GST_C_GTT1_like 93..218 CDD:198298 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.