DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and YGR201C

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:48/202 - (23%)
Similarity:82/202 - (40%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LELNSKLINTMEGDQLKPEFVRINPQHTIPTLV--DNGFVIWESRAIAVYLVEKYGKPDSP---L 86
            |:|:.||.:..:..||   :.|..|....||.|  .:.:.:.|:.||..||:......::.   |
Yeast    28 LKLDVKLADPSDAQQL---YEREFPLRKYPTFVGPHDEWTLTEAMAIDYYLIHLSSDKEAVRQLL 89

  Fly    87 YP-NDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQE---ALDKVNSAFGFLNTFLEG 147
            .| .|.:.||.|.:..........:.:.:.||.:.....:...|   |.:.|::........|:.
Yeast    90 GPEGDFKTRADILRWESLSNSDFLNEVCEVFFPLIGVKPYNATEFKAARENVDTIVSLYEKRLKK 154

  Fly   148 QDF-VAGSQLTVADIVILATVSTVEWFSFD---LSKFPNVERWLKNAPKVTPGWEQNLESLQQGK 208
            |.: |.....|:||::..|..|......||   .||.|.|.||.....| :..:|...||.:..:
Yeast   155 QQYLVCDDHETLADLISAAAFSLGFISFFDETWRSKHPEVTRWFNRVIK-SRFFEGEFESFKMCE 218

  Fly   209 KFLQDLQ 215
            ..:|.::
Yeast   219 TEMQPIK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 16/51 (31%)
GstA 6..188 CDD:223698 43/173 (25%)
GST_C_Delta_Epsilon 92..206 CDD:198287 28/120 (23%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 16/52 (31%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.