DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTF14

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:212 Identity:52/212 - (24%)
Similarity:92/212 - (43%) Gaps:20/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GLELNSKLINTMEGDQLKPEFV-RINPQHTIPTLVDNGFVIWESRAIAVYLVEKYGKPDSPLYPN 89
            ||:.....::.:.|:.....|: .:||...:|.|.|....::|.:||..||.|:|....:.|.|:
plant    27 GLDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQYKDVGTNLLPD 91

  Fly    90 DPQKRALINQRLYFD-------MGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTFLEG 147
            ||:|||:::..:..|       ..||...|....:....|.....||..:|::.......|.|..
plant    92 DPKKRAIMSMWMEVDSNQFLPIASTLIKELIINPYQGLATDDTAVQENKEKLSEVLNIYETRLGE 156

  Fly   148 QDFVAGSQLTVADIVILATVSTV------EWFSFDLSKFPNVERWLKNAPKVTPGWEQNLESLQQ 206
            ..::||...::||:..||.:..:      |..:...|: |||..|::.. |:.|.|.:.:..   
plant   157 SPYLAGESFSLADLHHLAPIDYLLNTDEEELKNLIYSR-PNVAAWVEKM-KMRPAWLKTVVM--- 216

  Fly   207 GKKFLQDLQAAKEKEVK 223
             |..:.||...:...:|
plant   217 -KNHIVDLMKQRRLPIK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 14/51 (27%)
GstA 6..188 CDD:223698 45/175 (26%)
GST_C_Delta_Epsilon 92..206 CDD:198287 28/126 (22%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 14/52 (27%)
GST_C_Phi 94..214 CDD:198296 28/121 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.