DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and clic3

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:208 Identity:39/208 - (18%)
Similarity:72/208 - (34%) Gaps:61/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEFVR-INPQHTIPTLVDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRL---YFD 104
            ||.:: :.|....|.|:.||.|..::..|..:|.:....|..|              :|   |.:
Zfish    51 PEVLKDLAPGSQPPFLIYNGEVRTDTNKIEEFLEDTLAPPQYP--------------KLCCRYKE 101

  Fly   105 MGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTFLE----------------------G 147
            ..|..|.:...|....:....|..:.|:|     .||.:.::                      .
Zfish   102 SNTAGDDIFHKFSAYIKNPNPGLNDMLEK-----KFLKSLMKLDQYLLTPLPHELDQNPELSTST 161

  Fly   148 QDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGWEQNLESLQQGKKFLQ 212
            :.::.|:.|::||..:|..:..|:   ....|:...|     .|....|..:.|:     |.:.:
Zfish   162 RHYLDGNALSLADCNLLPKLHIVK---VVCKKYRGFE-----IPAELKGLSKYLD-----KAYKE 213

  Fly   213 D---LQAAKEKEV 222
            |   |...|:||:
Zfish   214 DVFHLTCPKDKEI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 10/33 (30%)
GstA 6..188 CDD:223698 30/169 (18%)
GST_C_Delta_Epsilon 92..206 CDD:198287 21/138 (15%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 11/40 (28%)
O-ClC 6..237 CDD:129941 39/208 (19%)
GST_C_CLIC3 99..231 CDD:198332 26/146 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.