DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTF6

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:215 Identity:42/215 - (19%)
Similarity:82/215 - (38%) Gaps:48/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            |..:.::..|.:.|:|.:.:......::.....:...:|:..|..|:..||...:|...|..|.|
plant     1 MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKI 65

  Fly    66 WESRAIAVYLVEKYGKPDSPL------------------YPNDPQKRALINQRLYFDMGTLYDAL 112
            :|||||..|:..::....:.|                  :..||....|:.:::   :..||...
plant    66 FESRAITQYIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQV---LKPLYGMT 127

  Fly   113 TKYFFLIFRTGKFGDQEALDKVNSAFGFLNTF---LEGQDFVAGSQLTVADIVILATVSTVEWF- 173
            |.      :|....::..|.||      |:.:   |....::|....|:.|   |.|:..:::. 
plant   128 TD------KTVVEEEEAKLAKV------LDVYEHRLGESKYLASDHFTLVD---LHTIPVIQYLL 177

  Fly   174 ------SFDLSKFPNVERWL 187
                  .||  :.|:|..|:
plant   178 GTPTKKLFD--ERPHVSAWV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 18/72 (25%)
GstA 6..188 CDD:223698 41/210 (20%)
GST_C_Delta_Epsilon 92..206 CDD:198287 20/106 (19%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 18/72 (25%)
GST_C_Phi 91..208 CDD:198296 22/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.