DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTF5

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:229 Identity:53/229 - (23%)
Similarity:87/229 - (37%) Gaps:61/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRA 70
            :|.:|.:..:|.:..|....||..:...:|.:.|||.||.|:.|||...:|..:|.|..:.||||
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRA 130

  Fly    71 IAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGT---------------------------L 108
            |:.|:...:          ..:...|:|.:.|..|||                           :
plant   131 ISEYIATVH----------KSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPM 185

  Fly   109 YDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVS----- 168
            |...|.|..:       .:.||  |:..........|:...|:|.:..|:||:..|..:.     
plant   186 YGLKTDYKVV-------NETEA--KLEKVLDIYEERLKNSSFLASNSFTMADLYHLPNIQYLMDT 241

  Fly   169 -TVEWFSFDLSKFPNVERWLKNAPKVT--PGWEQ 199
             |...|    ...|:|.||:   .::|  |.|::
plant   242 HTKRMF----VNRPSVRRWV---AEITARPAWKR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/70 (36%)
GstA 6..188 CDD:223698 50/214 (23%)
GST_C_Delta_Epsilon 92..206 CDD:198287 28/143 (20%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 25/69 (36%)
GST_C_Phi 153..270 CDD:198296 25/132 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.