DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTF7

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:233 Identity:47/233 - (20%)
Similarity:87/233 - (37%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            |..:.::..|.:.|:|.:.:......|:.....|...:|:..|..|:..||...:|...|..|.:
plant     1 MAGIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKL 65

  Fly    66 WESRAIAVYLVEKYGKPDSPL-------------------YPNDPQKRALINQRLYFDMGTLYDA 111
            :|||||..|:...|....:.|                   :..||....|:.:::   :..||..
plant    66 FESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQV---LKPLYGM 127

  Fly   112 LTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTF---LEGQDFVAGSQLTVADIVILATVSTVEWF 173
            .|.      :|....::..|.||      |:.:   |....::|..:.|:.|   |.|:..:::.
plant   128 TTD------KTVVEEEEAKLAKV------LDVYEHRLGESKYLASDKFTLVD---LHTIPVIQYL 177

  Fly   174 SFDLSKFPNVERWLKNAPKVTPGWEQNLESLQQGKKFL 211
            ....:|     :.....|.|: .|..::.|....||.|
plant   178 LGTPTK-----KLFDERPHVS-AWVADITSRPSAKKVL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/72 (26%)
GstA 6..188 CDD:223698 39/203 (19%)
GST_C_Delta_Epsilon 92..206 CDD:198287 20/116 (17%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 19/72 (26%)
GST_C_Phi 95..209 CDD:198296 24/137 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.