DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTF4

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:213 Identity:46/213 - (21%)
Similarity:75/213 - (35%) Gaps:60/213 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRAIAVY 74
            |.:..:|.:..|.....|......:....|:.....|:.:||...:|...|....::|||||..|
plant    43 PFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQY 107

  Fly    75 LVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTL-------------------YDALTKYFFLIF 120
            :.          |.:..:...|:|.|.:..|.||                   ::.:.|..:   
plant   108 IA----------YVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKPIY--- 159

  Fly   121 RTGKFGDQ------EA-LDKVNSAFGFLNTF---LEGQDFVAGSQLTVADIVILATVS------T 169
              |...||      || |:||      ||.:   ||...|:|.:..|:.|:..|..:.      |
plant   160 --GLETDQTIVKENEAILEKV------LNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGTPT 216

  Fly   170 VEWFSFDLSKFPNVERWL 187
            .:.|    .|...|.:|:
plant   217 KKLF----EKRSKVRKWV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 16/66 (24%)
GstA 6..188 CDD:223698 46/213 (22%)
GST_C_Delta_Epsilon 92..206 CDD:198287 29/131 (22%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 16/65 (25%)
GST_C_Phi 126..243 CDD:198296 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.