DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTT2

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:235 Identity:64/235 - (27%)
Similarity:106/235 - (45%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            |.:|...|:..|||:.:..|...::.:..||:..:..||.|||..|||...:|.:||....::||
plant     3 LKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFES 67

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFG------- 126
            .||.:||...|.......||||..|||.|:..|.:....|....:.|..........|       
plant    68 HAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNPKA 132

  Fly   127 DQEALDKVNSAFGFLNTF-LEG--QDFVAGSQLTVADIVILATVSTVEWFSFD-----LSKFPNV 183
            ..||.:.:.::...|.|| |:|  :..:.|.|.::||:.::..:..::.....     ||....|
plant   133 AAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLRLLSPHKKV 197

  Fly   184 ERWLKNAPKVT-PGWEQNLESLQQGKKFLQDLQAAKEKEV 222
            |:|:::..|.| |..::..|.|.:.|...|     |::|:
plant   198 EQWIESTRKATMPHSDEVHEVLFRAKDRFQ-----KQREM 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 26/72 (36%)
GstA 6..188 CDD:223698 54/196 (28%)
GST_C_Delta_Epsilon 92..206 CDD:198287 29/129 (22%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 26/74 (35%)
GST_C_Theta 92..221 CDD:198292 29/128 (23%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.