DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTT1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:238 Identity:68/238 - (28%)
Similarity:107/238 - (44%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            |..|.:|...|:..|||:.:..|..|::.:..||:..:..||.|||..|||...:|.:||....:
plant     1 MMKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKL 65

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFF-------LIFRTG 123
            :||.||.:||...:.......||||..|||.|:..|.:....|......|..       |.....
plant    66 FESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALGLPLN 130

  Fly   124 KFGDQEALDKVNSAFGFLNTF-LEGQ-DFVAGS-QLTVADIVILATVSTVEWFSFD-----LSKF 180
            .....||...:..:...|.|| |:|. .|:.|| |.::||:.::..:..::.....     ||..
plant   131 PKAAAEAEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLSTH 195

  Fly   181 PNVERWLKNAPKVT-PGWEQNLESLQQGKKFLQDLQAAKEKEV 222
            ..||:|::|..|.| |.:::..|.|.:.|:..|     |.:|:
plant   196 KKVEQWIENTKKATMPHFDETHEILFKVKEGFQ-----KRREM 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/72 (38%)
GstA 6..188 CDD:223698 56/196 (29%)
GST_C_Delta_Epsilon 92..206 CDD:198287 32/129 (25%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 27/74 (36%)
GST_C_Theta 93..223 CDD:198292 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.