DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTF12

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:210 Identity:46/210 - (21%)
Similarity:83/210 - (39%) Gaps:32/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRA 70
            ||....|...:.:.:.....|:|.....|:....:|.|||.:...|...:|.:.|..|.::||||
plant     5 LYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRA 69

  Fly    71 IAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIF------------RTG 123
            ||.|...|:....:.|.....:.||:::|  :.|:.|       |:|.:.            |.|
plant    70 IARYYATKFADQGTNLLGKSLEHRAIVDQ--WADVET-------YYFNVLAQPLVINLIIKPRLG 125

  Fly   124 KFGDQEALDKVNSAFGFL----NTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVE 184
            :..|...::.:....|.:    |..|....|:||.:.|:||:..:..:..       |....::.
plant   126 EKCDVVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGY-------LMSITDIN 183

  Fly   185 RWLKNAPKVTPGWEQ 199
            :.:|........||:
plant   184 QMVKARGSFNRWWEE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/70 (30%)
GstA 6..188 CDD:223698 43/197 (22%)
GST_C_Delta_Epsilon 92..206 CDD:198287 23/124 (19%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 46/210 (22%)
GST_N_Phi 2..77 CDD:239351 21/71 (30%)
GST_C_Phi 91..209 CDD:198296 23/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.