DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTF2

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:213 Identity:44/213 - (20%)
Similarity:79/213 - (37%) Gaps:30/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            |..:.::..|.:.|:|.:.:......|:.....:...:|:..|..|:..||...:|...|....:
plant     1 MAGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKL 65

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYD-------ALTKYFFLIFRT- 122
            :|||||..|:..:|....:.|...|.:.   |:|.....:|...:       |....|..||:: 
plant    66 FESRAITQYIAHRYENQGTNLLQTDSKN---ISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSI 127

  Fly   123 -------GKFGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVAD------IVILATVSTVEWFS 174
                   ....::||  |:..........|:...::||...|:.|      |..|....|.:.| 
plant   128 YGLTTDEAVVAEEEA--KLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLF- 189

  Fly   175 FDLSKFPNVERWLKNAPK 192
               ::.|.|..|:....|
plant   190 ---TERPRVNEWVAEITK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 17/72 (24%)
GstA 6..188 CDD:223698 42/202 (21%)
GST_C_Delta_Epsilon 92..206 CDD:198287 23/122 (19%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 17/73 (23%)
GST_C_Phi 96..211 CDD:198296 22/115 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.