DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:214 Identity:48/214 - (22%)
Similarity:88/214 - (41%) Gaps:26/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            :.||...|:.....:.:.......|.....:|........|.|:.:||...:|.|.|:...::||
plant     3 MKLYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFES 67

  Fly    69 RAIAVYLVEKYGKPDSPLYPN-DPQKRALINQRLYFDM-----GTLYDALTKYFFLIFRTGKFGD 127
            |||..|:.||:....:.|..: ||::.|::  :|:.::     .....|:.....::...|:..:
plant    68 RAITAYIAEKHRDKGTDLTRHEDPKEAAIV--KLWSEVEAHHFNPAISAVIHQLIVVPLQGESPN 130

  Fly   128 ----QEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFD-----LSKFPNV 183
                :|.|:.:..........|....::||...|:||   |..|....:|...     ::..|||
plant   131 AAIVEENLENLGKILDVYEERLGKTKYLAGDTYTLAD---LHHVPYTYYFMKTIHAGLINDRPNV 192

  Fly   184 ERW---LKNAP---KVTPG 196
            :.|   |.:.|   ||:||
plant   193 KAWWEDLCSRPAFLKVSPG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 18/72 (25%)
GstA 6..188 CDD:223698 42/199 (21%)
GST_C_Delta_Epsilon 92..206 CDD:198287 25/125 (20%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 45/210 (21%)
GST_N_Phi 2..77 CDD:239351 18/73 (25%)
GST_C_Phi 92..208 CDD:198296 21/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.