DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTF11

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:177 Identity:43/177 - (24%)
Similarity:79/177 - (44%) Gaps:19/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DQLKPEFVRINPQHTIPTLVDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFD 104
            :|.||:.:...|...:|.:.|....::||||||.|...||....:.|.....:.||:::|.:..:
plant    39 EQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVE 103

  Fly   105 MGTLYD-ALTKYFFLIF--RTGKFGDQEALDKVNSAFG-FLNTF---LEGQDFVAGSQLTVADI- 161
            ....|. ||.....::|  ::||..|...::::...|. .|:.:   |....::.|.:.|:||: 
plant   104 NNYFYAVALPLVMNVVFKPKSGKPCDVALVEELKVKFDKVLDVYENRLATNRYLGGDEFTLADLS 168

  Fly   162 ------VILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGWEQNLE 202
                  .|:...|    .|..::...|:.||. |.....|.|::.:|
plant   169 HMPGMRYIMNETS----LSGLVTSRENLNRWW-NEISARPAWKKLME 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 13/36 (36%)
GstA 6..188 CDD:223698 39/161 (24%)
GST_C_Delta_Epsilon 92..206 CDD:198287 27/125 (22%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 43/177 (24%)
GST_N_Phi 2..77 CDD:239351 13/37 (35%)
GST_C_Phi 91..209 CDD:198296 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.