DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTF8

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:225 Identity:61/225 - (27%)
Similarity:98/225 - (43%) Gaps:29/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLI--NTMEGDQLKPEFVRINPQHTIPTLVDNGF 63
            |.::.::..||:.|:  ::::|.....:|..:||  :...|...:...:.:||...||.|.|...
plant    49 MASIKVHGVPMSTAT--MRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDL 111

  Fly    64 VIWESRAIAVYLVEKYGKPDSPLYPNDPQK-RALINQRLYFDMGTLYD--ALTKYFFLIFRTGKF 125
            .::|||||..||.|:|.:....|...|.:| :|..|..|..: |..:|  |....|..:|: |.|
plant   112 TLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVE-GQQFDPNASKLAFERVFK-GMF 174

  Fly   126 G-------DQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADI-------VILATVSTVEWFSFD 176
            |       .||...|:..........|...:|:||...|:||:       .:|.|.|.|   .||
plant   175 GMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKV---LFD 236

  Fly   177 LSKFPNVERWLKNAPKVTPGWEQNLESLQQ 206
              ..|.|..|:|.. ...|.|.:.::..:|
plant   237 --SRPKVSEWIKKI-SARPAWAKVIDLQKQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/74 (28%)
GstA 6..188 CDD:223698 56/200 (28%)
GST_C_Delta_Epsilon 92..206 CDD:198287 34/130 (26%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.