DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:127 Identity:27/127 - (21%)
Similarity:56/127 - (44%) Gaps:18/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWE 67
            :|.||::..:.:|:.:::|....||....:.::..:.:..:|.|:|:|....:|.::....:|.:
Human    46 SLVLYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISD 110

  Fly    68 SRAIAVYLVEKY----------GKPDSPL-YPND------PQKRALINQRLYFDMGTLYDAL 112
            ...|..|:...:          |.|..|| .|.:      |:..:|.:.|: .....|.|||
Human   111 YDQIIDYVERTFTGGGRGRCPSGFPAQPLAVPTEHVVALMPEVGSLQHARV-LQYRELLDAL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/72 (21%)
GstA 6..188 CDD:223698 26/124 (21%)
GST_C_Delta_Epsilon 92..206 CDD:198287 6/21 (29%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 27/126 (21%)
GST_N_GDAP1 47..119 CDD:239350 15/71 (21%)
GST_C_GDAP1L1 220..330 CDD:198335
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.