DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and VARS1

DIOPT Version :10

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_005249419.1 Gene:VARS1 / 7407 HGNCID:12651 Length:1265 Species:Homo sapiens


Alignment Length:151 Identity:35/151 - (23%)
Similarity:53/151 - (35%) Gaps:28/151 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PQHTIPTLVD--NGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRL-YFD-------M 105
            |...:|.|..  .|..:|.:.|:|..|     .|.....|...:...|:.|.: |.|       .
Human    53 PPPRLPALEQGPGGLWVWGATAVAQLL-----WPAGLGGPGGSRAAVLVQQWVSYADTELIPAAC 112

  Fly   106 GTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTV 170
            |....||.      .|:.....|..|..:..|...|..:|....::||...|:||:.  |..:.:
Human   113 GATLPALG------LRSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLA--AVTALL 169

  Fly   171 EWFSFDLSK-----FPNVERW 186
            ..|.:.|..     :.||.||
Human   170 LPFRYVLDPPARRIWNNVTRW 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 8/27 (30%)
GST_C_Delta_Epsilon 92..206 CDD:198287 25/108 (23%)
VARS1XP_005249419.1 GST_C_ValRS_N 92..213 CDD:198327 25/107 (23%)
PTZ00419 283..1265 CDD:240411
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.