DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and Gstt4

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:170 Identity:51/170 - (30%)
Similarity:87/170 - (51%) Gaps:10/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            |:||...::...||:.:.|:..|:..:.:.::.::|.....|::.|||...:|:|.|..|::.||
  Rat     3 LELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLRDGKFILSES 67

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFF--LIFR--TGKFGDQE 129
            .||..||..||..| |..||.|...||.:::.:.:....:...::|..:  ||..  ||:....|
  Rat    68 VAILCYLCRKYSAP-SHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTE 131

  Fly   130 ALDK----VNSAF-GFLNTFLEGQDFVAGSQLTVADIVIL 164
            .|||    ||... .|...||:.:.|:.|..:::||:|.|
  Rat   132 RLDKTLDEVNKNIKQFEEKFLQDKLFITGDHISLADLVAL 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GstA 6..188 CDD:223698 50/168 (30%)
GST_C_Delta_Epsilon 92..206 CDD:198287 22/82 (27%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 22/74 (30%)