DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstD10

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:211 Identity:111/211 - (52%)
Similarity:147/211 - (69%) Gaps:2/211 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSK-LINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWE 67
            :|||..|.:...|::.|.|||||:|.:.| :|||...:|..||:::||||||||||.|:||.:||
  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65

  Fly    68 SRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALD 132
            ||||.||||||||| |..|:|.|.||:|||||||||||||||.:.::|::......|..::|...
  Fly    66 SRAIMVYLVEKYGK-DDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYK 129

  Fly   133 KVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGW 197
            |:..||.|||||||||.:.||...::|||..||||||.:...||..::.||.||.:||.|:||||
  Fly   130 KIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGW 194

  Fly   198 EQNLESLQQGKKFLQD 213
            |:|....|:.:|:..:
  Fly   195 EENWAGCQEFRKYFDN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 41/73 (56%)
GstA 6..188 CDD:223698 99/182 (54%)
GST_C_Delta_Epsilon 92..206 CDD:198287 58/113 (51%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 41/73 (56%)
PLN02473 3..196 CDD:166114 106/193 (55%)
GST_C_Delta_Epsilon 89..205 CDD:198287 59/115 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468499
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.