DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and gstt1a

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:227 Identity:60/227 - (26%)
Similarity:108/227 - (47%) Gaps:28/227 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            |||::.|    .|::.:.||...:....|.::...|:|...||.:::....:|.|.|..|::.||
Zfish     7 LDLHSQP----CRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTES 67

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFR------TG---- 123
            .||.:||..|:..||. .||.|.||||.:::.|.:....:....:|.|:  |:      ||    
Zfish    68 IAILLYLAGKHSTPDH-WYPADLQKRAQVDEFLSWQHTNIRSHGSKVFW--FKGVLPAVTGAPVP 129

  Fly   124 KFGDQEALDKVNSAFG-FLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKF---PNVE 184
            |.....||:.:|.:.. |.:.||:.:.|:.|.::::||||  |.|..::..:..:..|   |.:.
Zfish   130 KEKMDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADIV--AIVEMMQPVATGVDVFEGRPALS 192

  Fly   185 RWLKNAPKVTPGWEQNLESLQQGKKFLQDLQA 216
            .|.....|     |..:|...:..|.:.::::
Zfish   193 AWRDRVKK-----EVGVELFDEAHKVIMNVES 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GstA 6..188 CDD:223698 54/195 (28%)
GST_C_Delta_Epsilon 92..206 CDD:198287 31/127 (24%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 56/200 (28%)
GST_N_Theta 3..78 CDD:239348 22/74 (30%)
GST_C_Theta 91..217 CDD:198292 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.