Sequence 1: | NP_525114.1 | Gene: | GstD7 / 48340 | FlyBaseID: | FBgn0010043 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_687373.1 | Gene: | gdap1l1 / 562163 | ZFINID: | ZDB-GENE-080812-2 | Length: | 367 | Species: | Danio rerio |
Alignment Length: | 262 | Identity: | 51/262 - (19%) |
---|---|---|---|
Similarity: | 96/262 - (36%) | Gaps: | 75/262 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
Fly 69 RAIAVYLVEKY-GK------PD--SPLYPNDPQKRALINQRLYFDMGT----LYDALT------K 114
Fly 115 YFFLIFR-------------------------------TGKFGDQEALDKVNSAFGFLNTFL--- 145
Fly 146 -----------EGQD---FVAGSQLTVADIVILATVSTVEWFSF------DLSKFPNVERWLKNA 190
Fly 191 PK 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD7 | NP_525114.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 15/72 (21%) |
GstA | 6..188 | CDD:223698 | 49/254 (19%) | ||
GST_C_Delta_Epsilon | 92..206 | CDD:198287 | 31/165 (19%) | ||
gdap1l1 | XP_687373.1 | GstA | 48..314 | CDD:223698 | 51/262 (19%) |
Thioredoxin_like | 48..120 | CDD:294274 | 15/71 (21%) | ||
GST_C_GDAP1L1 | 201..311 | CDD:198335 | 19/108 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589630 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |