DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and gdap1l1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:262 Identity:51/262 - (19%)
Similarity:96/262 - (36%) Gaps:75/262 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            |.||::..:.:|:.:::|....||....:.::....:|.:|.|:|:|....:|..:....::.:.
Zfish    48 LVLYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSDY 112

  Fly    69 RAIAVYLVEKY-GK------PD--SPLYPNDPQKRALINQRLYFDMGT----LYDALT------K 114
            ..|..|:...: |.      ||  :|:|....|.|.|:: .|..|..|    |:..||      |
Zfish   113 NQIIDYIETNFVGDTVAQLIPDEGTPMYARVQQYRELLD-GLPMDAYTHGCILHPELTTDSMIPK 176

  Fly   115 YFFLIFR-------------------------------TGKFGDQEALDKVNSAFGFLNTFL--- 145
            |.....|                               ..|..|.:.::.:....|.|...|   
Zfish   177 YATAEIRRHLANAASELMKLDHEEPQLTEPYLSKQKKLMAKILDHDNVNYLKKILGELAMVLDQV 241

  Fly   146 -----------EGQD---FVAGSQLTVADIVILATVSTVEWFSF------DLSKFPNVERWLKNA 190
                       :||.   ::.|...|:|||.:.||:..:::...      |.|: ||::.:.:..
Zfish   242 EAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRLKFLGLSRKYWEDGSR-PNLQSFFERV 305

  Fly   191 PK 192
            .|
Zfish   306 QK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/72 (21%)
GstA 6..188 CDD:223698 49/254 (19%)
GST_C_Delta_Epsilon 92..206 CDD:198287 31/165 (19%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 51/262 (19%)
Thioredoxin_like 48..120 CDD:294274 15/71 (21%)
GST_C_GDAP1L1 201..311 CDD:198335 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.