DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and gdap1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:222 Identity:44/222 - (19%)
Similarity:85/222 - (38%) Gaps:54/222 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            |.||::..:.:|:.:::.....||:.....::....:..:|.|:|:||...:|.||.:..||.:.
Zfish    40 LILYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVICDP 104

  Fly    69 RAIAVYLVEKYGKPDSP-LYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALD 132
            ..|..||.:.:....:| |.|.:.              .|.|..:..|            :|.||
Zfish   105 TQIMDYLEQNFCDEQTPKLIPEEG--------------STYYHRVQHY------------RELLD 143

  Fly   133 KVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGW 197
            .:.     ::.:..|  .:...::|| |..|.|..:|            ::...:.|.       
Zfish   144 SLQ-----MDAYTHG--CILHPEITV-DSHIPAYATT------------HIRTQIGNT------- 181

  Fly   198 EQNLESLQQGKKFLQDLQAAKEKEVKA 224
            |..|:.|......|:|...||::.:|:
Zfish   182 ESELKKLAVENPDLKDAYIAKQRRLKS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/72 (26%)
GstA 6..188 CDD:223698 34/182 (19%)
GST_C_Delta_Epsilon 92..206 CDD:198287 17/113 (15%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 44/222 (20%)
GST_N_GDAP1 40..112 CDD:239350 18/71 (25%)
GST_C_family 193..304 CDD:295467 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.