DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GDAP1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens


Alignment Length:262 Identity:52/262 - (19%)
Similarity:95/262 - (36%) Gaps:75/262 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            |.||::..:.:|:.:::|.....|:.....::....:..:|.|:|:|....:|.|:....:|.|:
Human    26 LILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEA 90

  Fly    69 RAIAVYLVEKY-------GKPD--SPLYPNDPQKRALINQRLYFDMGT----LYDALT------K 114
            ..|..||.:.:       ..||  |..||.....|.|::. |..|..|    |:..||      .
Human    91 TQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDS-LPMDAYTHGCILHPELTVDSMIPA 154

  Fly   115 YFFLIFRTGKFGDQEA---------------------------------------LDKVNSAFGF 140
            |.....|: :.|:.|:                                       ||::......
Human   155 YATTRIRS-QIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQ 218

  Fly   141 LNTFL---------EGQD-FVAGSQLTVADIVILATVSTVEWFSF-----DLSKFPNVERWLKNA 190
            :.|.|         |||. ::.|...|:||:.:..|:..:::..|     ...|.||:|.:.:..
Human   219 VETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERV 283

  Fly   191 PK 192
            .|
Human   284 LK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 17/72 (24%)
GstA 6..188 CDD:223698 50/254 (20%)
GST_C_Delta_Epsilon 92..206 CDD:198287 30/165 (18%)
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 16/71 (23%)
GST_C_GDAP1 179..289 CDD:198336 18/107 (17%)
Required for mitochondrial localization 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.