Sequence 1: | NP_525114.1 | Gene: | GstD7 / 48340 | FlyBaseID: | FBgn0010043 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061845.2 | Gene: | GDAP1 / 54332 | HGNCID: | 15968 | Length: | 358 | Species: | Homo sapiens |
Alignment Length: | 262 | Identity: | 52/262 - (19%) |
---|---|---|---|
Similarity: | 95/262 - (36%) | Gaps: | 75/262 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
Fly 69 RAIAVYLVEKY-------GKPD--SPLYPNDPQKRALINQRLYFDMGT----LYDALT------K 114
Fly 115 YFFLIFRTGKFGDQEA---------------------------------------LDKVNSAFGF 140
Fly 141 LNTFL---------EGQD-FVAGSQLTVADIVILATVSTVEWFSF-----DLSKFPNVERWLKNA 190
Fly 191 PK 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD7 | NP_525114.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 17/72 (24%) |
GstA | 6..188 | CDD:223698 | 50/254 (20%) | ||
GST_C_Delta_Epsilon | 92..206 | CDD:198287 | 30/165 (18%) | ||
GDAP1 | NP_061845.2 | GST_N_GDAP1 | 26..98 | CDD:239350 | 16/71 (23%) |
GST_C_GDAP1 | 179..289 | CDD:198336 | 18/107 (17%) | ||
Required for mitochondrial localization | 320..358 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154509 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |